Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

961 – 975 of 115,944 results

961

Invitrogen™ Mouse IL-6 (ELISA Standard) Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	21-28 kDa
Common Name	IL-6
Gene Symbol	Il6
Storage Requirements	4°C
Sequence	Mouse IL-6, amino acids Phe25-Thr211 (Accession # MMINTL6)
Expression System	E. coli
For Use With (Application)	Neutralization,ELISA Standard
Name	Mouse IL-6 (ELISA Standard)
Accession Number	P08505
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	B-cell differentiation factor; B-cell hybridoma growth factor; B-cell stimulatory factor 2; BSF2; BSF-2; CDF; CHIL-6; CTL differentiation factor; cytokine; HGF; H-IL-6; HSF; hybridoma growth factor; Ifnb2; IFN-beta-2; Il6; IL-6; ILg6; ILN; interferon beta-2; Interleukin; interleukin 6; Interleukin 6 (interferon, beta 2); interleukin 6 precursor; interleukin BSF-2; interleukin HP-1; Interleukin6; Interleukin-6; interleukin-6 precursor; interleukin-6 protein; M-IL-6; prointerleukin 6; R-IL-6
Product Type	Protein
Gene ID (Entrez)	16193
Formulation	Protein with no preservative
Recombinant	Recombinant

962

Novus Biologicals™ PHPT1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	PHPT1
Molecular Weight (g/mol)	15.9kDa
Gene ID (Entrez)	29085
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 2mM DTT, 10% glycerol
Immunogen	PHPT1, 1-125 aa. MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

963

Novus Biologicals™ Recombinant Human Profilin 1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

964

Novus Biologicals™ Recombinant Human DFF45/ICAD His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

965

Novus Biologicals™ Recombinant Human PTTG1 His Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

966

R&D Systems™ Recombinant Mouse Thrombospondin-1 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

967

Novus Biologicals™ Recombinant Human VEGF Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability
Specifications

Conjugate	Unconjugated
Molecular Weight (g/mol)	19.9kDa
Gene Symbol	VEGFA
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Baculovirus
Name	Human VEGF Protein
Regulatory Status	RUO
Purification Method	>85%, by SDS-PAGE
Gene Alias	MVCD1, vascular endothelial growth factor A, Vascular permeability factor, VEGF-A, VEGFMGC70609, VPFvascular endothelial growth factor
Product Type	Recombinant Protein
Gene ID (Entrez)	7422
Formulation	Phosphate buffered saline (pH 7.4), 30% glycerol, 1mM DTT, 0.1mM PMSF
Immunogen	APMAEGGGQN HHEVVKFMDV YQRSYCHPIE TLVDIFQEYP DEIEYIFKPS CVPLMRCGGC CNDEGLECVP TEESNITMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQENPCGPC SERRKHLFVQ DPQTCKCSCK NTDSRCKARQ LELNERTCRC DKPRRHHHHH H
Cross Reactivity	Human
Recombinant	Recombinant

968

R&D Systems™ Recombinant Human Megalin/LRP-2 (C3) Protein

R&D Systems™ Recombinant Human Megalin/LRP-2 (C3) Protein CF is a large type I transmembrane cell surface protein.

Pricing & Availability

969

Gibco™ Human CCL13 (MCP-4) Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	>98% by SDS-PAGE
Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	8.6 kDa
Common Name	MCP-4
Gene Symbol	CCL13
Activity	ED50 = 10-100 ng/mL; determined by the dose-dependent chemotaxis of human blood cells.
Endotoxin Concentration	<0.1 ng/μg
Storage Requirements	4°C
Sequence	Human CCL13 recombinant protein contains 75 amino acids
Expression System	E. coli
For Use With (Application)	Bioactivity
Name	Human CCL13 (MCP-4)
Accession Number	Q99616
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	C-C motif chemokine 13; C-C motif chemokine 13, long chain; C-C motif chemokine 13, medium chain; C-C motif chemokine 13, short chain; C-C motif chemokine ligand 13; CCL 13; CCL13; chemokine (C-C motif) ligand 13; CKb10; CK-beta-10; H-MCP-4; MCP4; MCP-4; Monocyte chemoattractant protein 4; monocyte chemotactic protein 4; NCC1; NCC-1; new CC chemokine 1; SCYA13; SCYL1; small inducible cytokine subfamily A (Cys-Cys), member 13; small-inducible cytokine A13
Product Type	Protein
Gene ID (Entrez)	6357
Formulation	Protein with no preservative
Recombinant	Recombinant

970

Novus Biologicals™ MOG1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	MOG1
Formulation	Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 0.15M NaCl, 1mM DTT
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Source	Human

971

Novus Biologicals™ EMAP-II/AIMP1 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>85%
Conjugate	Unconjugated
Common Name	EMAP-II/AIMP1
Molecular Weight (g/mol)	39.2kDa
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 2mM DTT, 10% glycerol
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.25mg/mL
For Use With (Application)	SDS-PAGE

972

Gibco™ Human alpha-Defensin 1 Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	≥98% by SDS-PAGE and HPLC
Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	3.4 kDa
Common Name	DEFA1
Gene Symbol	DEFA1
Activity	ED50 = 1 - 10 ng/mL; determined by the dose-dependent chemotaxis of immature dendritic cells.
Endotoxin Concentration	<0.1 ng/μg
Storage Requirements	-20°C
Sequence	Human alpha-Defensin 1 recombinant protein contains 30 amino acids
Expression System	E. coli
For Use With (Application)	Bioactivity
Name	Human alpha-Defensin 1
Accession Number	P59665
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	alpha-defensin 1; Cryptdin-1; DEF1; Defa1; DEFA1B; DEFA2; Defcr; Defcr1; defensin alpha 1; defensin related cryptdin peptide 1; defensin, alpha 1; defensin, alpha 1, myeloid-related sequence; defensin, alpha 2; defensin-1; defensin-related cryptdin peptide; HNP-1; HNP-2; HP 1-56; HP1; HP-1; HP-2; MRS; myeloid-related sequence; neutrophil defensin 1; Neutrophil defensin 2
Product Type	Protein
Gene ID (Entrez)	1667
Formulation	Protein with no preservative
Recombinant	Recombinant

973

Gibco™ Human Wnt-1 Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Purity or Quality Grade	≥98% by SDS-PAGE and HPLC
Conjugate	Unconjugated
Form	Lyophilized
Molecular Weight (g/mol)	34.8 kDa
Common Name	WNT1
Gene Symbol	WNT1
Activity	ED50 = 1.5 - 2.5 ng/mL; determined by the dose-dependent enhancement of alkaline phosphatase production by murine ATDC5 cells treated with BMP-2 (200 ng/mL).
Endotoxin Concentration	<0.1 ng/μg
Storage Requirements	-20°C
Sequence	Human Wnt-1 recombinant protein contains 343 amino acids
Expression System	E. coli
For Use With (Application)	Bioactivity
Name	Human Wnt-1
Accession Number	P04628
Regulatory Status	RUO
Purification Method	Purified
Gene Alias	BMND16; INT1; Int-1; murine mammary tumor virus integration site; OI15; Proto-oncogene Int-1; proto-oncogene Int-1 homolog; proto-oncogene protein Wnt-1; proto-oncogene Wnt-1; sw; swaying; wingless-related MMTV integration site 1; Wingless-type MMTV integration site 1 homolog; Wingless-type MMTV integration site 1, homolog; wingless-type MMTV integration site family member 1; wingless-type MMTV integration site family, member 1; wingless-type MMTV integration site family, member 1 (oncogene INT1); Wnt family member 1; Wnt1; Wnt-1
Product Type	Protein
Gene ID (Entrez)	7471
Formulation	Protein with no preservative
Recombinant	Recombinant

974

R&D Systems™ Recombinant Human MMP-9 Western Blot Standard Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Western Blot

Pricing & Availability

975

R&D Systems™ Recombinant Mouse Bcl-2 related protein A1 Western Blot Std

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

Prev
1
...
63
64
65
66
...
7,730
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ PHPT1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human Profilin 1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human DFF45/ICAD His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PTTG1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human VEGF Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ MOG1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ EMAP-II/AIMP1 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PHPT1 Protein

Novus Biologicals™ Recombinant Human Profilin 1 Protein

Novus Biologicals™ Recombinant Human DFF45/ICAD His Protein

Novus Biologicals™ Recombinant Human PTTG1 His Protein

Novus Biologicals™ Recombinant Human VEGF Protein

Novus Biologicals™ MOG1 Protein

Novus Biologicals™ EMAP-II/AIMP1 Protein